PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G083400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 296aa    MW: 32949.8 Da    PI: 7.6481
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G083400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1771.7e-5598192397
               NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                         eqdrflPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv +lkvyl+kyre+
  Potri.005G083400.1  98 EQDRFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGSLKVYLNKYRET 188
                         8****************************************************************************************** PP

               NF-YB  94 egek 97 
                         egek
  Potri.005G083400.1 189 EGEK 192
                         **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-5393215IPR009072Histone-fold
SuperFamilySSF471136.68E-4199211IPR009072Histone-fold
PfamPF008083.3E-27102166IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.1E-19130148No hitNo description
PROSITE patternPS006850133149IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.1E-19149167No hitNo description
PRINTSPR006154.1E-19168186No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MFEGVNQVIA YYYPPYGTYQ IAEGRNSSLI GSHNKNLKSK TLVSSPNPPS PTYPFFWHLA  60
SSLLLHIWLP KMTGKGTQSS PIGSPSSENI SDSSSKLEQD RFLPIANVSR IMKKSLPANA  120
KISKEAKETV QECVSEFISF ITGEASDKCQ REKRKTINGD DLLWAMTTLG FENYVGSLKV  180
YLNKYRETEG EKNSMARQED QLSPTNHGTV GTHETNKVNG TLTDPSTEMD LQSFNNGLYS  240
LGTEVTAKSY GENTRLLGYQ ENFMAGDFNM NRIGENGDRN SERARAAQLY HGVRW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-4598187392Transcription factor HapC (Eurofung)
4g92_B7e-4598187392Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.135110.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4603190.0KC460319.1 Populus nigra x Populus x canadensis nuclear transcription factor YB7 (NFYB7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306345.21e-166hypothetical protein POPTR_0005s08510g
TrEMBLB9H5A01e-166B9H5A0_POPTR; Uncharacterized protein
STRINGPOPTR_0005s08510.11e-166(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-61nuclear factor Y, subunit B3